.
The Open Protein Structure Annotation Network
PDB Keyword
.

282081

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282081
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18812,TM0201, BV2255C Molecular Weight 67648.85 Da.
    Residues 608 Isoelectric Point 8.22
    Sequence mrrffknnlrnlsqngetnsvrrcfaladvtvvingrtltvpdnltvieacekagieipalchhprlge sigacrvcvvevegarnlqpacvtkvrdgmviktssdrvktarkfnlalllsehpndcmtceangrcef qdliykydvepifgygtkeglvdrsspaivrdlskcikcqrcvracselqgmhiysmverghrtypgtp fdmpvyetdcigcgqcaafcptgaivensavkvvleelekkekilvvqtapsvrvaigeefgyapgtis tgqmvaalrrlgfdyvfdtnfgadltimeegseflerlekgdledlpmftsccpgwvnlvekvypelrt rlssakspqgmlsamvktyfaeklgvkpedifhvsimpctakkdealrkqlmvngvpavdvvlttrelg klirmkkipfanlpeeeydaplgistgaaalfgvtggvmeaalrtayelktgkalpkivfeevrglkgv reaeidldgkkiriavvhgtanvrnlvekilrrevkyhfvevmacpggciggggqpysrdpeilrkrae aiytidermtlrkshenpaikklyeeylehplshkahellhtyyedrsrkkrlavk
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch