.
The Open Protein Structure Annotation Network
PDB Keyword
.

282084

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282084
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18814,TM0204, BV1071, _0000.000295_, _0000.000321_, 89366 Molecular Weight 27110.56 Da.
    Residues 233 Isoelectric Point 8.82
    Sequence meevevilkveglrkdfngvkvienwgfsvgkgervallgpsgcgkttflrivsgledyqgkvkvftdk igyvfqeprlipwktitenlmlirrdtdriasllekvelkgfenhypwqlsegmkqrvnfvrallvdpd lllldepfdaldlktkmkvmdllvdlwqkrrfsivfvthnvkeavflserifllsgrpskildevklke kaidftdeklfrlekmvierllnllr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch