.
The Open Protein Structure Annotation Network
PDB Keyword
.

282088

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Crystal Structure
    Target Id 282088
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS1992,TM0208, 89353 Molecular Weight 51889.60 Da.
    Residues 466 Isoelectric Point 6.13
    Sequence mrstkivctvgprtdsyemiekmidlgvnvfrintshgdwneqeqkilkikdlrekkkkpvailidlag pkirtgylekefvelkegqiftlttkeilgnehivsvnlsslpkdvkkgdtillsdgeivleviettdt evktvvkvggkithrrgvnvptadlsvesitdrdrefiklgtlhdveffalsfvrkpedvlkakeeirk hgkeipviskietkkalerleeiikvsdgimvargdlgveipieevpivqkeiiklskyyskpvivatq ilesmienpfptraevtdianaifdgadallltaetavgkhpleaikvlskvakeaekkleffrtieyd tsdiseaishacwqlseslnakliitptisgstavrvskynvsqpivaltpeektyyrlslvrkvipvl aekcsqelefiekglkkveemglaekgdlvvltsgvpgkvgttntirvlkvd
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0208

    Name: pyruvate kinase
    Metabolic Subsystem: Glycolysis/Gluconeogenesis
    Reaction: : adp + h + pep --> atp + pyr
    Classification: EC:2.7.1.40
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0208
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch