.
The Open Protein Structure Annotation Network
PDB Keyword
.

282098

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282098
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18815,TM0218, 84842 Molecular Weight 48323.01 Da.
    Residues 438 Isoelectric Point 6.15
    Sequence mkdilkelkkklseedfnkfngrvtrvvgltveskgpdaflgemckislqngknalaevvgfreesvil mpyedvsglkmgcevirtnkvlevgvsrkmigrvfdglgrpidgkpfvpedryplinnppnplkrrrik dplpvgirsidgfitigkgqrigifagsgvgkstllgmiarnttadinvlaligergrevrefierdlg eeglkrsilvvstsdqpalarvkslltatsiaeffrdlgydvllmvdsltrwamaqrevglavgepptt rgyppsvfaglpkileragnsdkgsitaiytvlveaddfnepisdtvrsivdghiilsrrlaesnhypa vdvlasvsrlmndivteehreaanrlrslmsayesakdlieigayksgtnplvdkavemkdeidsflkq gvfekasfeetlqklldlylrsld
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0218
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch