.
The Open Protein Structure Annotation Network
PDB Keyword
.

282118

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282118
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2006,TM0239, 84872 Molecular Weight 42239.86 Da.
    Residues 370 Isoelectric Point 9.02
    Sequence mrvlglilaggksdrlwpltkvrasaavpvfgkyraidftlsnmvnsgirkvgiltqynprslmdhlgs gkewdldrksgglfilqpyvgpnrevwyrgtadaifqnmtilrrgeedhvligsgdhiykmiyrdlfny hlkkgaditlvvkeldetynlseygivqldddmrvveieekpahpkgniaflgvyfmnkellkellyat vpqgkydllldivipnldrlkvyayrfdgywrnvkkgikeyyrinmdilkkevrdelfyrngkvytklk dlpppkftttavvensliadgsivsgtvrnsvifrnvrikvgavvensiimentvveegavlrnvildk ncivregrviegdtelpvfekravl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0239

    Name: glucose-1-phosphate adenylyltransferase
    Other genes that carryout this rxn:TM0240
    Metabolic Subsystem: Glycogene synthesis
    Reaction: : atp + g1p + h --> adpglc + ppi
    Classification: EC:2.7.7.27
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0239
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch