.
The Open Protein Structure Annotation Network
PDB Keyword
.

282138

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282138
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS25563,TM0261, 89354 Molecular Weight 42691.67 Da.
    Residues 402 Isoelectric Point 9.68
    Sequence mtiliiagilgfimafsigandvansmatavgaraitvrqaaliamfleflgavmfgshvsqtivkgiv evekvqpvelmygalsaliaasfwiliatnwgypvstthsivggmmgfglvavgingvnwktflfivls wvvspvlgglisfvmfklislsvfhtknpkksstvaipffislaiftmislfvkktlkqplsesfllgi afslvtffvvhfavrklinekkdvydavenvfkraqiltscyvsfshgandvanaagpvaavmivastg vvpktveipflalllggigislgvfflgqkvmetvgekittltnsrgftvdfstattvllasslglpis tthvvvgavtgvgfarglemvnvgvlkniviswllivptvaatsaavywvlklilkf
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0261

    Name: phosphate transport in via proton symport
    Other genes that carryout this rxn:TM0917
    Metabolic Subsystem: Transport
    Reaction: h[e] + pi[e] --> h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0261

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch