.
The Open Protein Structure Annotation Network
PDB Keyword
.

282159

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282159
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2021,TM0283, 84852 Molecular Weight 28181.09 Da.
    Residues 254 Isoelectric Point 6.41
    Sequence mrstdrllfidfllkfenkngtvipccvdnfdctfthkggksmyekerkelynahlllekyglvaytsg nvsvrigdhvlikpsgvpytelkpedfvvvdlegnviegekkpsvdtathlylykhldwaksvihthst famvwaileksipvlctahadvfgeeiplteyapvgseaigkavvkvigksgavllrkhgvmivgtsvd davkkaifleevakaayfatlagkptplppdevdhlynqyhtkygqk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0283

    Name: L-ribulose-phosphate 4-epimerase
    Metabolic Subsystem: Carbohydrate Metabolism
    Reaction: : ru5p-L <==> xu5p-D
    Classification: EC:5.1.3.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0283
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch