.
The Open Protein Structure Annotation Network
PDB Keyword
.

282164

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282164
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18832,TM0288, BV1071, _0000.000765_, 382442 Molecular Weight 67704.53 Da.
    Residues 598 Isoelectric Point 8.92
    Sequence mpeirrrphgpilekpalknptatlrrllgylrphtftlimvfvfvtvssilgvlspyligktidvvfv prrfdllprymlilgtiyaltsllfwlqgkimltlsqdvvfrlrkelfeklqrvpvgffdrtphgdiis rvindvdninnvlgnsiiqffsgivtlagavimmfrvnvilslvtlsivpltvlitqivssqtrkyfye nqrvlgqlngiieedisgltviklftreekemekfdrvneslrkvgtkaqifsgvlpplmnmvnnlgfa lisgfggwlalkdiitvgtiatfigysrqftrplnelsnqfnmiqmalasaerifeildleeekddpda velrevrgeiefknvwfsydkkkpvlkditfhikpgqkvalvgptgsgkttivnllmrfydvdrgqilv dgidirkikrsslrssigivlqdtilfsttvkenlkygnpgatdeeikeaaklthsdhfikhlpegyet vltdngedlsqgqrqllaitraflanpkilildeatsnvdtkteksiqaamwklmegktsiiiahrlnt iknadliivlrdgeivemgkhdeliqkrgfyyelftsqyglvveke
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch