.
The Open Protein Structure Annotation Network
PDB Keyword
.

282167

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282167
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2025,TM0291, 84841 Molecular Weight 45445.02 Da.
    Residues 418 Isoelectric Point 5.94
    Sequence mgktlaekifsehvgrdvkageivlarvdiamaqdgtgplminefrelgfkevkvpkaflfidhaspsp rkelsnsqkmmrefgkemgvkvfdagdgishqilaekyvkpgdlvagadshtctagglgafgtgmgstd vaiifglgqnwfkvpetikvvvngklqdgvyakdiileiarilgsdgatykalefhgscienmnvedrl tisnmavevgakaglmpsdektreflkkmgreedfrelkadpdavyeteieidattleplvslphyvdn vrkvsevekekikidqvfigtctngrlqdleialkilekhgkhpdvrlivgpasrkvymdalekgiikk fvelgaavippgcgpcvgihmgvlgdgervlstqnrnfkgrmgnpnaeiylaspataaatavtgyitdprrfi
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0291

    Name: aconitase
    Other genes that carryout this rxn: TM0292
    Metabolic Subsystem: Citric Acid Cycle
    Reaction: : cit <==> icit
    Classification: EC:4.2.1.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0291
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch