.
The Open Protein Structure Annotation Network
PDB Keyword
.

282173

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282173
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18834,TM0297, 382447 Molecular Weight 27884.67 Da.
    Residues 257 Isoelectric Point 6.13
    Sequence mnileklfslkrkvalvtgggqgigkaiaqalaaagaavlimdineetarrtveeikekggeadfyvgd vtkeedcfgavkkaldrwgkldigvnnagigdwceaenypvekwkkvidvnlvgvflsakaefhamker kygkiiniasmsghivnkpqkqtaynaskagvihltrslaaewapygirvnsispgyirtpliespnvk dlvplwldmiplgrlgevddligaaiflaspasdymtghdlvidggytvw
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0297
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch