The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282174
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2028,TM0298, _0003.000446_ Molecular Weight 34867.84 Da.
    Residues 317 Isoelectric Point 5.63
    Sequence mkvlliekpgvasvvekeipvpgedqtlvkvlacgicgtdykifsggtnanypvvpgheivgvversgv fekgqmvvidpnrscgkcdycrkgmsqfcenlqatgvtepggfaeyvlvensqvypvrnvpaeravfae plscvlegvkmvkhgfydrilvvgagsigvifglifkkifpgaeivlaekdekraeyvvqtfglkvdep kgeydltvecsgtvegfktcfehtgkggmllqfsviskdkmveispfeiyrkemkilgsylnpftmkea vkiiesgefpfeklvtdrldlegvkeylsshkkalmkgifs
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary





    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch