.
The Open Protein Structure Annotation Network
PDB Keyword
.

282178

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282178
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18837,TM0302, 89360 Molecular Weight 32655.32 Da.
    Residues 289 Isoelectric Point 9.30
    Sequence mkrilrlffdmwedlrfkyavtvltalvllsilsifspydpykwyvlptnqppslehilgtdgkgqdif wlltfslknslilatiaavfsriiaitigmlsgylggttdrilmaltdtfmvmpvfplllllsslikny lslpilgliigvfgwagdarvirsmilslrerefvvtskfsgmrtfevvfgdfvpylipvisggfigsm mgaigfeivlailgftrveiptlgsmfhwminfqamllgywwwvltpivtavflftalytlslsineyl dprtrmqrigavk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0302

    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn: TM0303 TM0301 TM0300 TM0304
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan6[e] + h2o[c] --> adp[c] + glucan6[c] + h[c] + pi[c]

     
    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn: TM0303 TM0301 TM0300 TM0304
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan4[e] + h2o[c] --> adp[c] + glucan4[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0302
    generated 12/2008
    Transmembrane protein

    HMM_TM0302

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch