.
The Open Protein Structure Annotation Network
PDB Keyword
.

282179

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    3. 3. References

    Site JCSG
    Status Purified
    Target Id 282179
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2030,TM0303, BV1071, 282144 Molecular Weight 37009.01 Da.
    Residues 328 Isoelectric Point 8.68
    Sequence mekiavaenlrayyfiksgdkttsiravdnvslhffenevygiagesgcgkstllkvlfgeikpplklv dgevvfkldgeeyrinsmsldqlkkirwkyvsyvpqgsmsvlnpvrkirrifldvieehtsmsreeafs riesyfealglpvrvldsyphqlsggmrqrvtialatvlnpkvifadepttaldvvvqrgviqllkkih keqkntlvivthdmgvhahlatrigvmyagrlieeaetheifknplhpytrflinslprfgdrsrkegt pgsppslanlpsgcpfhprcpiadqicmemepdlievarnhkvacwkvgver
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0303

    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn:TM0302 TM0301 TM0300 TM0304
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan6[e] + h2o[c] --> adp[c] + glucan6[c] + h[c] + pi[c]

     
    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn:TM0302 TM0301 TM0300 TM0304
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan4[e] + h2o[c] --> adp[c] + glucan4[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0303
    generated 12/2008

    Protein Summary


    Ligand Summary


    References

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch