.
The Open Protein Structure Annotation Network
PDB Keyword
.

282180

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282180
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18838,TM0304, _0000.000321_, BV1071, 84844 Molecular Weight 35859.48 Da.
    Residues 316 Isoelectric Point 6.38
    Sequence mrvsvrnltkifrvgsifslkklvaidnvsfeigsgeifslagesgcgktttakillgleeptngevly dgiklkdfvenemhflkkvqtvqqnpfstfnpfrkvedylfktvlrfkmantkdealrlieeklsvvgl nfdeikgrypsefsggqlqrisiaralltnpsflvadepvsmidaslrisivnlfrdlkerfgisilyi thdlstayyvadklaimfrgsivemgraqdildtpfhpytkllkssipvpdpeyewdeninlssteree ffakgckfasrcpevmsicresvppdfdvngrvvkcwlyk
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0304

    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn:TM0302 TM0303 TM0301 TM0300
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan6[e] + h2o[c] --> adp[c] + glucan6[c] + h[c] + pi[c]

     
    Name: glucan transport via ATP transporter
    Other genes that carryout this rxn:TM0302 TM0303 TM0301 TM0300
    Metabolic Subsystem: Transport
    Reaction: atp[c] + glucan4[e] + h2o[c] --> adp[c] + glucan4[c] + h[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0304
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch