The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282181
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18839,TM0305 Molecular Weight 79492.36 Da.
    Residues 707 Isoelectric Point 5.41
    Sequence mlrsflilflailgvvfgatfewksveingggfvpgiifhpaspgllyartdvgglyrwdeetkrwkql fdflrrdqsdymgvlsvaldpsdpkriyamtgkytqdwagygailisedygetwtivnldkygikvggn edgrnagerlqvdpnfssvlfmgttkyglwksedfgknwkkvdsfpstsvtfvlfdeksgekgsptpri fvgcsepkgifvtedggttwnvlpnlpndliplrgkihdgilyvtlsnalgpngatrgavmkyviadqk wydvtpmkgdfgycgidvqenvvivstldrwyphdeifislnggetwrpllekanfdinkapwikdlnp hwisdvkidpfdmnraifttgygvwvtyelkksfegmgkpvkwifenrgleetvvlqlvppigerplls aiadwggfrhesldtppssmykplkwtslgiafayqnskfvarvhtytypflsysedgginwreietvp egitdggrlslavsndgktlvwspanhevivssdkgkswkkaisvpvpefnyfpasdpvnpskfyifdw kngdfliskdggksfmkgaklpsfdnwwvslysfpvlapdregdiwlalqwnglyrskdggitferlgn vdiayvigfgapkpgtdypaiylngmvngvygifmstdegktwmrinndkhqfgwihymigdmnefgri flgtegrgiivgevkee
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0305

    Name: "endoglucanase (beta-1,4 glc) (extracellular)"
    Other genes that carryout this rxn: TM1525
    Metabolic Subsystem: Cellulose Metabolism
    Reaction: : cell500 + h2o --> cell4

    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM1525
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan1500 + h2o --> glucan4

    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn:TM1525
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan1500 + h2o --> glucan4 + glucan6

    Name: "glucan hydrolysis by beta-1,4- and beta-1,3 glucosidase"
    Other genes that carryout this rxn: TM1525
    Metabolic Subsystem: Glucan Metabolism
    Reaction: : glucan1500 + h2o --> glucan6

    Name: hydrolysis of glucomannan (extracellular)
    Other genes that carryout this rxn: TM1227
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman600 + h2o --> glcman6
    Classification: EC:
    Name: hydrolysis of glucomannan (extracellular)
    Other genes that carryout this rxn: TM1227
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman600 + h2o --> glcman4 + glcman6
    Classification: EC:
    Name: hydrolysis of glucomannan (extracellular)
    Other genes that carryout this rxn: TM1227
    Metabolic Subsystem: Mannan Metabolism
    Reaction: : glcman600 + h2o --> glcman4
    Classification: EC:

    Ligand Information
    Model TM0305
    generated 12/2008
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch