.
The Open Protein Structure Annotation Network
PDB Keyword
.

282191

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282191
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32941,TM0315 Molecular Weight 10308.60 Da.
    Residues 83 Isoelectric Point 6.59
    Sequence mcpfcfwswgfwpwnwgggvimmifwavilvflfvflfrwlggerhervertdraleilkerfargeit eeeyermkrkiqne
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0315

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch