.
The Open Protein Structure Annotation Network
PDB Keyword
.

282223

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282223
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18854,TM0348, 89291 Molecular Weight 56382.53 Da.
    Residues 492 Isoelectric Point 5.53
    Sequence mriflvgmmgsgkstigkrisevldlqfidmdeeierregrsvrrifeedgeeyfrlkekellkelver dnvvvatgggvvvdpenrellkkektlflyappevlmervttenrpllsegkerireiwekrkqfyaef rridtsrlnewettalvvlealdekeistiekphlvkiilggfkrvrneelvfttervekiygrylpen rllfpdgeevktlehvsrayyelirmdfprgktiagvgggaltdftgfvastfkrgvglsfypttllaq vdasvggknaidfagvknvvgtfrmpdyviidptvtlsmdegrfeegvveafkmtilsgrgvelfdepe kiekrnlrvlsemvkisveekarivmedpydmglrhalnlghtlghvyemlegvphgiavawgieketm ylyrkgivpketmrwivekvkqivpipvpsvdvekarnlilndkkilkgsrvrlpyvkeigkieflevd plellevvd
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0348

    Name: shikimate kinase
    Metabolic Subsystem: Chorismate Biosynthesis
    Reaction: : atp + skm --> adp + h + skm5p
    Classification: EC:2.7.1.71
     
    Name: 3-dehydroquinate synthase
    Metabolic Subsystem: Chorismate Biosynthesis
    Reaction: : 2dda7p --> 3dhq + pi
    Classification: EC:4.2.3.4
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0348
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch