.
The Open Protein Structure Annotation Network
PDB Keyword
.

282237

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282237
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18861,TM0362, 282182 Molecular Weight 32433.25 Da.
    Residues 287 Isoelectric Point 5.65
    Sequence mikigahmpiskgfdrvpqdtvniggnsfqifphnarswsaklpsdeaatkfkremkkhgidwenafch sgylinlaspkddiwqksvellkkeveicrklgirylnihpgshlgtgeeegidrivrglnevlnnteg vvillenvsqkggnigykleqlkkirdlvdqrdrvaitydtchgfdsgyditkkegveallneieslfg lerlkmihlndskyplgaakdrherigsgfigeegfavffsfkeiqevpwiletpggneehaedikkvf eiiekfgievd
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0362
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch