.
The Open Protein Structure Annotation Network
PDB Keyword
.

282247

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282247
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18867,TM0372 Molecular Weight 111698.81 Da.
    Residues 1000 Isoelectric Point 8.30
    Sequence mkiaeisskrpiaifmllmavvflgfisfqhlkldllpqieypyavvittymgagteeveelvtkpleg yisstpgvrrftsmsmdsvsfilvefdwnvktseavgrlsryvdlatrdlpeganpvvvefdpsllpvy afsteddyedvvskikrlpevasvevmgkpekivevildqekikrfdvdpslietilsgnlvypfgyvs dsegniypvsvdgrfeniedlkntivgfrgvkyqsllqgkvpnilvpvrlrniaevnitnesvqgevrv ngkkasliaiykrsgantvktvreikrilrdskinyieamnqayyteraidnllknllygfiaafvvvl iflkdftstivtsfsiplsltitfvllyafglnldtltlgglimalgmlvdnsivvfeniyrhrslgdp ipdaarkgagevwlailastlttvsvflpivfftgfvvrlfkyfaiafvfalssslfvstvvvpagtrw ikprrgkltealqkhyrkalewclkrkklvlvisfalvaisviyllskplgflpsfqtnlmvidvklps qssyektaeavkqiedylnehrneykissfyaevgitnvysqimgrgqnearimvnlggsrrefaknre klknaisqlnipeakievleqsqqiyeilgypvtievrgddlsliqekakeiferlrklqevkkiqirn sfekevlhvkidrnkalmngvvagqvfldlqtyllgkkigtlrteegtlpivlkkakflspedlskisl tglkgdvplgvvsnisretlpsivehsdgervvyvdlvsvegsigevakkvekllneidlsgvkveitg qksfmdeafselqyvvyiaialvymilaaqfesfvlpfvifftipfavvgvafavfvngyslnvpvlvg lltlsgtvvnnaivmltrieqirqekglleatlegaqsrlrpilmttfttivallptalshaegseies piswvvifgmlismlftlfvipviyaairrkvrv
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch