.
The Open Protein Structure Annotation Network
PDB Keyword
.

282248

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282248
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18868,TM0373, _0061.004648_, _0004.000970_ Molecular Weight 66048.16 Da.
    Residues 596 Isoelectric Point 5.27
    Sequence maekkefvvgidlgttnsviawmkpdgtvevipnaegsrvtpsvvaftksgeilvgepakrqmilnper tiksikrkmgtdykvriddkeytpqeisafilkklkndaeaylggeikkavitcpayfndaqrqatkea giiaglevlriineptaaalaygldkagkeekvlvydlgggtfdvsileigegvieviatagnnhlggd dfdqrlidwmaeefkkqhgidlredrqalqrlrdaaekakielstkmetdvslpfiavspsgqplhlem ritrslfesltrdlvemtrgpieqalndaklspqdideiilvggmtrvpmvqrfikeffgkepnksvnp deavaigaaiqaailagtegakgrdivlvdvtpltlgievkgglfepiiprntkipvrkskifttvedg qteveirvyqgerpiareniflgsfklvgippaprgvpqievtfdidsdgivhvsakdlgsgkeqsmvv tgrhklsedeikrmiedakryeeqdkrlkeeielknraddlaysvektlkehgdkipadlksrledmir elrdainrndipkvkmlfddlqkesmkigeylyksatggetsnq
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0373
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch