.
The Open Protein Structure Annotation Network
PDB Keyword
.

282253

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282253
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18871,TM0379, 84679 Molecular Weight 47595.55 Da.
    Residues 443 Isoelectric Point 5.78
    Sequence mrydvvvvgggpaglvaafttkrffgdkkilvvkktekemvpcgipyifhtlgsvendymgiedrfkga gidllidevvdgnpdekklftksgkeisydkliiatgsspnipkipgvdlkgvftvpkeadylkllhek vkdandvviigggfigvevadeikksgknvtlveimdsllpvsfdpdfgelarkelesdnvkvltgrkv teilgtekvegvkldsgetipadvvvlatgykpnselarklglkvtelgfietdeymrtskpdifaagd cvqhkdfltgkpsrlmlasaavfdariaasnlyglkvirtnkgslnaystvigskafgsvgiteriake egfevvvgkaeapdrhpgkfedtsklvvklifsedskillgaqvcggksvgeivnlislgiqkgitand lftmqigthplltsaptvyplakaaemvl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0379

    Name: riboflavin kinase
    Metabolic Subsystem: Riboflavin Metabolism
    Reaction: : atp + ribflv --> adp + fmn + h
    Classification: EC:2.7.1.26
     
    Name: FMN adenylyltransferase
    Metabolic Subsystem: Riboflavin Metabolism
    Reaction: : atp + fmn + h --> fad + ppi
    Classification: EC:2.7.7.2
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0379
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch