.
The Open Protein Structure Annotation Network
PDB Keyword
.

282291

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282291
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS26218,TM0418, 89290 Molecular Weight 51358.53 Da.
    Residues 443 Isoelectric Point 5.17
    Sequence mrkflmtivlmvsllifaeeititawtvgpdnpsyyrfdnlktaaerlnkilkdlgvdltikvdgyfdt tdwssfkqkvvfgiksgqtvdiicsghddigawakagyiipldeyvkkywdevyydfipslwestkykg qiygipqdtearpfyinkqvlkklgwsdeeinslpdriargeftfedfievareaiekglvewglyhrp kagidyyqlmismgidfydeekavfvynveemkdyykllydlantykilpknmigtpwtsvhkdvtggk vlawmggtwnwaewkkdygkteeelqemfilapvpkfrdrgrpntlshpvvymipstskypdiafllit lasapelnmrhavesghlpirwqqtvlpeytkefimmegtkllpysgfipnddmfnlynqiifegmqma esgmnpekvaedvakrlksqlkdrvviie
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0418

    Name: inositol transport in via ABC transport
    Other genes that carryout this rxn:TM0420 TM0421 TM0419
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + inost[e] --> adp[c] + h[c] + inost[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0418
    generated 12/2008
    Transmembrane protein

    HMM_TM0418

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch