.
The Open Protein Structure Annotation Network
PDB Keyword
.

282292

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282292
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18900,TM0419, 282600 Molecular Weight 33820.40 Da.
    Residues 294 Isoelectric Point 8.67
    Sequence mkklkpwlllspllifviiffvipviltvviaftdmdysftwnfvgfqnfkdistdfiiprviantfiy tfgtlglfnlgtalllsllttsisdrwgnffrtlwmlprltpsvvygllwlwmfdpteyglvnfirglf glppqdwlhsapmwmiifangfigasmgmlvftaaiksipedyyraaridgaswfmivrkitlplikwh llfvtayqtlsllasfeyiliitdggpvyrtevwalytyhnafshfrfgygaalsiilviigvisafvy mkffgfeslmekpkveve
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0419

    Name: inositol transport in via ABC transport
    Other genes that carryout this rxn:TM0420 TM0421 TM0418
    Metabolic Subsystem: Transport
    Reaction: atp[c] + h2o[c] + inost[e] --> adp[c] + h[c] + inost[c] + pi[c]

     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0419
    generated 12/2008
    Transmembrane protein

    HMM_TM0419

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch