.
The Open Protein Structure Annotation Network
PDB Keyword
.

282306

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282306
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18914,TM0433, 89330 Molecular Weight 40605.32 Da.
    Residues 367 Isoelectric Point 5.37
    Sequence mlmrfsrvvslvlllvftavltgavkaslndkpvgfasvptadlpegtvgglggeivfvrtaeelekyt taegkyvivvdgtivfepkreikvlsdktivgindakivggglvikdaqnviirnihfegfymeddprg kkydfdyinvenshhiwidhctfvngndgavdikkysnyitvswckfvdhdkvslvgssdkedpeqagq aykvtyhhnyfknciqrmprirfgmahvfnnfysmglrtgvsgnvfpiygvasamgakvhvegnyfmgy gavmaeagiaflptrimgpvegyltlgegdaknefyyckepevrpveegkpaldpreyydytldpvqdv pkivvdgagagklvfeelntaq
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0433
    generated 12/2008
    Transmembrane protein

    HMM_TM0433

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch