.
The Open Protein Structure Annotation Network
PDB Keyword
.

282318

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282318
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18922,TM0445, BIG_267, 84984 Molecular Weight 45088.98 Da.
    Residues 404 Isoelectric Point 5.30
    Sequence mrlpdagfrryivvagrrnvgkssfmnalvgqnvsivseyagtttdpvyksmelypvgpvtlvdtpgld dvgelgrlrvekarrvfyradcgilvtdseptpyeddvvnlfkemeipfvvvvnkidvlgekaeelkgl yesryeakvllvsalqkkgfddigktiseilpgdeeipylgdlidggdlvilvvpidlgapkgrlimpq vhairealdreaialvvkerelryvmenigmkpklvitdsqvvmkvasdvpedvelttfsivesryrgd layfvesvrkieeledgdtvvimegcthrpltedigrvkiprwlvnhtgaqlnfkviagkdfpdleeie gakliihcggcvlnraammrrvrmakrlgipmtnygvtisylhgvldrairpfreevkv
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0445
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch