The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282320
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18924,TM0447, 84972 Molecular Weight 42558.00 Da.
    Residues 380 Isoelectric Point 5.25
    Sequence mkkigiigggqlgkmmtleakkmgfyvivldptprspagqvadeqivagffdseriedlvkgsdvttyd lehidvqtlkklynegykihpspytleiiqdkfvqkeflkkngipvpeyklvkdlesdvrefgfpvvqk arkggydgrgvfiiknekdlenaikgetyleefveiekelavmvarnekgeiacypvvemyfdedanic dtviaparieekyskiareiatsvvealegvgifgiemfltkqgeilvneiaprphnsghytieacvts qfeqhiraimnlplgstellipavmvnllgeegyygkpaligleealaieglslhfygkketrpyrkmg hftvvdrdveralekalrakkilkvvseegamcqg
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0447

    Name: phosphoribosylaminoimidazole carboxylase
    Other genes that carryout this rxn:TM0446
    Metabolic Subsystem: Purine Biosynthesis
    Reaction: : air + co2 <==> 5aizc + h
    Classification: EC:

    Ligand Information
    Model TM0447
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch