.
The Open Protein Structure Annotation Network
PDB Keyword
.

282348

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282348
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS86822,TM0475, RER070207002378 Molecular Weight 24693.90 Da.
    Residues 214 Isoelectric Point 5.19
    Sequence mselakepvlktggpegpcgfeshrlrqprtglfflggenvrallvvdlqrdfvdeggalyfegaekvi npilkwveefkkenlpiittqdwhdpedrefniwpkhcvantdgarlteklekalkdypnhfsvkknry safyntnlekiirdneideiyvcgvvthicvlftveelrnrdipvkiitegvasydeelhrfalremke ilgaefi
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch