.
The Open Protein Structure Annotation Network
PDB Keyword
.

282351

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282351
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18958,TM0478 Molecular Weight 46183.98 Da.
    Residues 401 Isoelectric Point 5.84
    Sequence mtpeeqvkilkrnvvdliseeelldrikrkgklrvklgvdpsrpdlhlghavvlrklrefqdlghtvvl iigdftarigdpsgrnetrpmltkeevlenaktyqeqafkildpkrtelrfngewldrmtfadviilas kytvarmlerddfakrfkegipiaiseflyplaqaydsvaiqsdvelggtdqlfnllvgrkiqeeygqe pqivmtmpiiegtdgklkmsksygnyiafndppeemygklmsipdeliikymrlltdipeerieeyerk mkektinprdvkmvlayeitrffhgeenakkaqehfvkvfqkkeipdempvveisqeknivdllveiga asskseakrlvsqggvyidgeriedikftvepdgervlrvgkrkfyrisggetkkl
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0478

    Name: tyrosyl-tRNA synthetase
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : atp + trnatyr + tyr-L --> amp + ppi + tyrtrna
    Classification: EC:6.1.1.1
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0478
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch