.
The Open Protein Structure Annotation Network
PDB Keyword
.

282390

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282390
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2076,TM0517, 282245, 90102 Molecular Weight 24330.72 Da.
    Residues 204 Isoelectric Point 9.33
    Sequence mkrvnmnlawmgvvfsamssillleyyreilagspsytlgtvtlflslistisllivyrqwsvllninv lqtlrlaeqrsvnlnekpfvpnwpyiafiafwfleflfagiwffsllqliffviflhylfetirklqei kihlyrtlfnidykpvikernvlsvflltlftlgvywlylvvrlsreinefldmddrimrnlevks
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0517

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch