.
The Open Protein Structure Annotation Network
PDB Keyword
.

282401

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282401
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS18998,TM0528 Molecular Weight 35326.11 Da.
    Residues 313 Isoelectric Point 9.11
    Sequence mrivfvgtpefaaeilehlikngfnvvgvvtqpdkprgrgrkvaptpvkavaekhevpfiqpesinkke aleflrsvrpdviivasygkilgekvlslprlgcynihpsllpkyrgaspiqrvlengeertgvtiykm vkeldagpialqkeisvdpfetfdqlekrlielskemliefleklktgnielkeqdhsratyapmikke dlivdfskdaesvknkiraydsrpgaraflgnvevklfgvtaidssgdepglinyidregawigtgdgk vkvryiqfpgkkkmtfweakngrliiegmrferryes
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0528

    Name: Methionyl-tRNA formyltransferase
    Metabolic Subsystem: tRNA Metabolism
    Reaction: : 10fthf + mettrna --> fmettrna + h + thf
    Classification: EC:2.1.2.9
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0528
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch