.
The Open Protein Structure Annotation Network
PDB Keyword
.

282412

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282412
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19010,TM0539 Molecular Weight 46384.00 Da.
    Residues 422 Isoelectric Point 6.06
    Sequence mrivvnlkpeeipkhwynvladlpfkldppldpetkqpispeklsvifpmslieqevseerfieipepv lkeyavyrptpliratfleeylqtpariyykyegvsptgshkpntaiaqayynkiegvkrlvtetgagq wgsalsyagakfglevkvfmvkvsyqqkpmrkymmnlfggkvtpspseetnfgrkilsedpdnpgslgi aisealevavsdpntkyslgsvlnhvllhqtvigleikkqleligekpdillgchgggsnfggtilpfv pdklsgrdirfvacepaacpsltkgnydydfgdtagltpllkmytlgkdfippkihagglryhgsapii arlvkeglveaqafdqdetfeaakifaklegiipapesahaiagaireakkakeegkervivftlsghg lldltayv
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0539

    Name: tryptophan synthase (indole)
    Other genes that carryout this rxn: TM0138
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : indole + ser-L --> h2o + trp-L
    Classification: EC:4.2.1.20
     
    Name: tryptophan synthase (indoleglycerol phosphate)
    Other genes that carryout this rxn:TM0138 TM0137
    Metabolic Subsystem: Phenylalanine Tyrosine Tryptophan Biosynthesis
    Reaction: : 3ig3p + ser-L <==> g3p + h2o + trp-L
    Classification: EC:4.2.1.20
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0539
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch