.
The Open Protein Structure Annotation Network
PDB Keyword
.

282418

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282418
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19012,TM0545, 382444 Molecular Weight 31294.33 Da.
    Residues 281 Isoelectric Point 6.26
    Sequence mkvlvpatttnlgagfdvfglaldlfnevefsfdtkettiestgkyasdlkdhnlffevlrfferktgy rvppvrikqtcnipvssglgssaavivaalhianegtgrnlsredlmklaveleghpdnvvpaftgglv vcyqngshldfekfeidlsltflvpnfpvctnemrkilpekvpfedavfniknscqflakiaagkikea lkyvgdrlhqnyringnkkmkefveailsknpeywfvsgsgpsvcsnindfegipylkdvlklrvnnrg mivse
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0545

    Name: homoserine kinase
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : atp + hom-L --> adp + h + phom
    Classification: EC:2.7.1.39
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0545
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch