.
The Open Protein Structure Annotation Network
PDB Keyword
.

282420

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282420
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19014,TM0547, _0067.000935_, _0062.000769_, 433363 Molecular Weight 81430.49 Da.
    Residues 739 Isoelectric Point 6.40
    Sequence mrtyrsfkmftnssqgvrkvrvgiaglgtvggsiyrilkergneiekrigekfiiskvinrspqkyell gvpkeeiafdfddlilnsdvvveaiggtdvavdlvrralelgrivvtpnknliseygnefseyikkrkl ffeasvgggipiisllqdylifqkvtrirgimngttnyiltemskgrhfeevlkeaqelgyaeadptnd iegydvaykvsvlagvvtgrfpginsvqfegitridpeylkeivrsgkklkligeldfstnryevrlre vtpedpffnvdgvdnaievstdlagdfllkgrgaggyptasaviadlfrvakykvlggaekfsvvvmkf ggaaisdveklekvaekiikrkksgvkpvvvlsamgdttdhlielaktidenpdpreldlllstgeiqs valmsialrkrgykaisftgnqlkiitdkrygsariidintdiisrylkqdfipvvagfqgitetgdit tlgrggsdltaialayslgadlcelykdvdgvytadprivkdarvikelsweemielsrhgaqvlqara aefarkygvkvliknahketrgtliwegtkvenpivravtfedgmakvvlkdvpdkpgvaarimrtlsq mgvnidmiiqgmksgeyntvafivpesqlgkldidllktrseakeiiiekglakvsivgvnltstpeis atlfetlaneginidmisasssrisviidgkyvedavkaihsrfeldre
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0547

    Name: aspartate kinase
    Other genes that carryout this rxn: TM1518
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : asp-L + atp <==> 4pasp + adp
    Classification: EC:2.7.2.4
     
    Name: homoserine dehydrogenase (NADPH)
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : hom-L + nadp <==> aspsa + h + nadph
    Classification: EC:1.1.1.3
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0547
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch