.
The Open Protein Structure Annotation Network
PDB Keyword
.

282421

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282421
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19016,TM0548, 89390 Molecular Weight 64428.05 Da.
    Residues 584 Isoelectric Point 5.50
    Sequence mvhvkmkgskmlfeallkegvdtifgipggaiinvydelcnyedkinfylfrheqgathaadgyarvtg kpgvvivtsgpgatntvtgiataymdsipivvitgqvptsfigtdafqevdvtgitmpitkhnhlvtsi eelpyaikemfyvattgrpgpvlldfpkdiqtaegefnypdtveipgykptvkghpkqikkavellkes krpvvivggganlsgamdlvnqfidkfkvpavstlmgrgvnpsdeklyyegigmhgtyygnyavanadl iialgvrfsdrilgnprtfaknarivhvdidpaeigknvrvdvpivgdlksvleeflkyeietdfsdwi eelqeikkkypltykrdgklikpqyvvekvnevfpddtvvvadvgqnqmwvaqfykfkhqrsflcsggl gtmgyalpagigakigapdkevvvfagdggfqmniqelmtikrynlpvkiivmdnkalgmvrqwqqlff ncrysatilsdnpdfakiaeavgikamriekpdqvdeaieklakskepmlihavvdpaenvlpmvppgg dvgtplieapydetfvervlkvieesrrgder
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0548

    Name: 2-aceto-2-hydroxybutanoate synthase
    Other genes that carryout this rxn: TM0549
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 2obut + h + pyr --> 2ahbut + co2

     
    Name: acetolactate synthase
    Other genes that carryout this rxn: TM0549
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : h + pyr --> alac-S + co2
    Classification: EC:4.1.3.18
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0548
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch