.
The Open Protein Structure Annotation Network
PDB Keyword
.

282423

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Diffraction-quality Crystals
    Target Id 282423
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2087,TM0550, 289536 Molecular Weight 38044.95 Da.
    Residues 336 Isoelectric Point 5.94
    Sequence maviyydkdadlnlikdkkiaiigygsqghahalnlkdsglnvvvglregskswkkaeeqgltvktiee aakeadiimilipdehqpeiykkyiekhltegkmlmfahgfnihyhqiippknvdvtmiapkspghivr reyvegrgvpalvavyqdytgkakdialayakgigvtragviettfkeetetdlfgeqavlcggvtali kagfetlvdagyqpeiayfeclnelklivdliyegglsfmrysvsntaeygdyisqekivtkevrenmk qmlkdiqtgkfakdwilenqagrpyfytmrkkesehliekvgkelrkmmpwlkernvdee
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0550

    Name: 2-dehydropantoate 2-reductase
    Metabolic Subsystem: Pantothenate and CoA Metabolism
    Reaction: : 2dhp + h + nadph --> nadp + pant-R
    Classification: EC:1.1.1.169
     
    Name: ketol-acid reductoisomerase (2-Acetolactate)
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 2ahbut + h + nadph <==> 23dhmp + nadp
    Classification: EC:1.1.1.86
     
    Name: "ketol-acid reductoisomerase (2,3-dihydroxy-3-methylbutanoate)"
    Metabolic Subsystem: "Valine, Leucine, and Isoleucine Metabolism"
    Reaction: : 23dhmb + nadp <==> alac-S + h + nadph
    Classification: EC:1.1.1.86
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0550
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch