.
The Open Protein Structure Annotation Network
PDB Keyword
.

282430

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282430
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19020,TM0557 Molecular Weight 121310.28 Da.
    Residues 1099 Isoelectric Point 5.09
    Sequence mpkredikrilvigsgpitigqaaefdysgtqalkalksagyeviivnsnsatimtdpefsdavyiepl tveflekiiekerpdallptlggqtalnlavelaergildkygvqligaklesikkaedrelfketmek aglevlrsrlvnnladaletarefgypviirpsftlggtgggiafneeelrdivtkgliespvhtvlie esvlgwkeyelevvrdgagnfivvcsienldpmgihtgdsitvapaqtltdveyqrmrdaaykvidaig ietggsniqfaldpetgrmvviemnprvsrssalaskatgypiakvaallavgftldeipnyitgktma afepsidyvvvkiprfqlekfpgadprlntqmksvgevmaigrtfkealgkalrsleldaapkldlehi rehlanptperisyvfaafrngmdveevheltkidrwflremkacieleeelklkkfdveilkkakqwg ysdreiaeiwgvsekeirkmrednrifpvykmvdtcaaefeaqtpyyystyngveneavpsdrekimil gsgpnrigqgiefdytnvhgvwsfqeegyetimvnsnpetvstdydtsdrlyfepltvedvleivrnek pkgvvvafggqtplkiakylveervniigtsfesieiaedrekfakllkqiglkcppfgtassveealr vaenlgypvlvrpsyvlggramaivdtpqelemyvkeaavvspgypvlidkfledaieldvdvvsdgky vwiaglmeqieeagvhsgdsacvlppvslseklveeieetvyklvkalkvvgvaniqlavkdeeiyiie anprasrtvpfvskaigipvariaakimvgrnlpellseyfpyptrpgvkvdklgeseilptpwpkmfs vkevvipfhkfpgtdvllgpemrstgevmgigedfaeafakaqiaagnplpttgailatvadkdkreav pllahladmgfeiyatrgtakalqshgvevkvvpkvgegrpdvidlleqgkislvvitqssdepalvav shgkepfkvegrrtvgymirttalkrkipylttveslraavaairkmkkgsivkvrrltdtwkm
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0557

    Name: carbamoyl-phosphate synthase (glutamine-hydrolysing)
    Other genes that carryout this rxn: TM0558
    Metabolic Subsystem: Pyrimidine Biosynthesis
    Reaction: : atp + gln-L + h2o + hco3 --> adp + cbp + glu-L + h + pi
    Classification: EC:6.3.5.5
     

    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch