.
The Open Protein Structure Annotation Network
PDB Keyword
.

282431

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282431
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19022,TM0558 Molecular Weight 42928.09 Da.
    Residues 392 Isoelectric Point 5.97
    Sequence mskkallaledgsfffgqslgaegetfgelvfntgmtgyqevltdpsytgqivvmtypeigiygvnded vesdgikvagfvvyrsvdtpsnwratmsfpdylkkynivaiegvdtraltrkirvkgamkgaistvdld pdslvkrvkespsivgrdlaglvspkevivenpegdfsvvvldsgvkwgilrdlkrvgakvmrvpysvd iddikklnpdgvlisngpgdpaallktirlikdllkeeiplagiclghqllglavggrtykmkfghrgi nhpvkdlrtgrvlitthnhgfavdpksfglpelgsedqdanvltknlqkisvlegispqgikveithis lndgtmegmrlvdypafsvqyhpeaspgphdakyffeefkrlikevr
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0558

    Name: carbamoyl-phosphate synthase (glutamine-hydrolysing)
    Other genes that carryout this rxn:TM0557
    Metabolic Subsystem: Pyrimidine Biosynthesis
    Reaction: : atp + gln-L + h2o + hco3 --> adp + cbp + glu-L + h + pi
    Classification: EC:6.3.5.5
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0558
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch