.
The Open Protein Structure Annotation Network
PDB Keyword
.

282456

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282456
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2096,TM0583, 282234 Molecular Weight 48687.17 Da.
    Residues 434 Isoelectric Point 6.19
    Sequence mlkekllsktallgviglgyvglplavekakagyrvlgfdiqkkrvdmvnrgenyigdvvdedlkdlve kgmirattdfsemkncdvvticvptplgkykepdltyvintakeiakylhremlvvlesttypgtteev vlpilestglkvgkdfylafspervdpgnkiyktkntpkvvggvtekctelakilyenvleapvhtvss praaemakvlentfrlvnislinevaivarrmginiwevidaaatkpfgfmpfypgpgagghcipidpf ylaykakeydvrldlvemageindfmpeyvvmrvqdilnerkkplngskvlllgvaykgdiddtrespa lkvwdhlekkkavveffdpyvpevkrgdrihrrvelteeylkgvdivvittahkngvdydfvvknapvv fdtknitkdvkenrdkiill
      BLAST   FFAS

    Pathway

    Reactions found in Metabolic Reconstruction for TM0583

    Name: UDPglucose 6-dehydrogenase
    Metabolic Subsystem: Galactose metabolism
    Reaction: : h2o + nad + udpg --> h + nadh + udpglcur
    Classification: EC:1.1.1.22
     

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0583
    generated 12/2008

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch