The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Cloned
    Target Id 282491
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19084,TM0618, BIG_209, BIG_343 Molecular Weight 150909.65 Da.
    Residues 1289 Isoelectric Point 7.82
    Sequence mslsnpllavdrarvskllikdsemtdlfdllvkrglklpvfkydlttdryilekpgeinfegteeeiv rkisrlyslsklsieekgvvtlfmtfgvlkwndpgfktpylsapvvmvpcefeknkhtnqvsrinffge giqfnpvlellfrekydlplpqieeidsknfneiiehlgnlktqftiwkvipqcwiislnpemfvlysd lgkmmqntealthplinafsgvlslsksstesvssvplvpilradssqrkilemvregenvvihgppgt gksqtianiiadavarektvlfvsakkaaldvvynrlknaglgrfcleihstrkskqelmfdlkrtidl lqnfqdveqpadllkqfehlknnlnnllnslhrtdhplgmsiydaisrleglkdypvihslhlssiaei skerfekilqlmekleqladvynesqhpwkgfkfsenilsyplkviemleyvkmnlknmkqmlekagft dignlrfedfqkilyllkslknvdvlpgrwfqveieelstlreiveilrkrkvlmkkyfqhteksieem teilqpverfsrswlrilnpsywkwkkfvnrnlryphnfeeiqrlyeisknlidteikyndlkekipdq efsfdeyrtkeleeidfalikldialkirkklpikiikndliltrvskdlisraieiledtqlkkymed lnrlwpdgfvgektlqtapvdelirkidhlianesklhewiqlqetleslekmelktfirsvekehvkn irrifeksfykqwidnvctldknlrdfsseryeqdiltlekaeealrkrwvqyvksllakkfrtiladt nhsqqirilmretqkkrrhkpirkflleisdilrfvkpcilmsplsvssfldldkfinyfdivifdeas qlrtpeaisavvrgkqiivagdpkqlpptnffksyyeleddederepldsfldecialprvfkqgylrw hyrsrderliafsnhyfygenplitfpspkyrnsdqgiklvyvengtwdragkrvntmealkvvdivie hfqkhpdrsigvvtmntsqsdlienllqrrlmeyphlmdvifkesnepffikslenvqgderdtiiisi gyartpsgelfynfgplnneggwrrlnvlitraryqiilvtslrsedlsransenkgvaalrnylkyae qncklefcrsygesddiiptsiarqlnnigfltdtnigmglcqvsvgiedpedpgrykigiihdgknha miqdvidrevlkfkvleslgwklkrlwtiewyrdpekvlkniiehlk
      BLAST   FFAS
    Ligand Information

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch