.
The Open Protein Structure Annotation Network
PDB Keyword
.

282494

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282494
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19090,TM0622, _0085.000952_, _0063.005062_, _0037.002508_, BIG_364, _0020.002700_, _0051.000870_, _0093.002836_, _0061.000710_, 84915 Molecular Weight 43645.87 Da.
    Residues 388 Isoelectric Point 9.65
    Sequence mikvlhiipslavggaeklvsdmvefadrsrfdvavmritgtdsflvekltskgyqvytivldyeaiap skvirrllraiknmrrtynllreirpdiihshlsalrialipallcripvkvhtihtvaekdakgitrf fnriafkffgfvpvsisqevaesvkklygrkistpviyngidvqkfsidqpkrvdrdktilinvarlsr eknhallvrafskavqscpnlelwlvgdgelrrdieelvkqlgleekvkffgvrsdvpellsqadifvl ssdyegfglvvaeamaaglpviataiggipeileggragilvppkdvdalakaivelardekkraelsd ygrklvaerfdirrtvreyeklylellekkkgskkfrikgnvl
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch