.
The Open Protein Structure Annotation Network
PDB Keyword
.

282510

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282510
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32161,TM0638 Molecular Weight 109617.89 Da.
    Residues 992 Isoelectric Point 4.87
    Sequence mkraliflflliavfslsytirkgdvlrievvgypdltrscavdiegaitfpyvgrvkveglsvdqvtd llkerlsrsfsepevivslqqiaprnvyvsgvvnrvvnmgiedlsvsellsllsvdlssvdlskvkvlr dgkvfeldlssllwgeapekdvmlqendqvilpeksytefvkivgavskpgiypyrremtlldavaaag gttqessgkiivlskdetvevsekdiyqknlllkpgdtvhvqkiderfayvvgavarpgmytfsreesl tlknliakaggvsvdkrfiekalitrggetleydpdvldenveievgdvveikkfektevyvsgyvsrp gvyeispkenvtlekllsmaggikgtleevdsivvtrdgsvitlspnnldfsvkpgdvvnvkefvpkka yvlgyvrnpglytfgkneaftlrnliakaggfvdegqvvsvkvagkeyspdeivkedilledgvfvyve rytdrfvymvgdnvsrngkmsfekeepftlstalkkygiedfslikslsllrngremtfdpekiltedv plekgdtilvrtvqtkrvyftgdvygyvdfakdeditlekalarfgkvqrkyiaglkvimdgrvqkfde lvdvpledgavvelnlkesirvyvdgfvrapqmvvfepdetpvldraivkaggyredtlfeagnitvlr dgheitvpkeqtssfeledgdlvfvkyrekthvyvfgegitntlvtfedeetptlrsvlgkvggvkstg serivvvkpdgekeevdyeeviktggpvlesgsvvfvpletenfayvvgevarpgayelkgdvtllkli aqagglsnwalrtkvilrrgekeftydftsieevqnvkvepgdvvyvppvetnyvyvlgnvknpgivkv drystvfdvvmraggftekaaasriflfrggpqgevtvcdlsgvlsgkgggvnlnvspgdvvfvpdnpl iqvtealsivntifstirnvkdvmgw
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0638
    generated 12/2008
    Transmembrane protein

    HMM_TM0638

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch