.
The Open Protein Structure Annotation Network
PDB Keyword
.

282516

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282516
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19102,TM0644, BIG_760 Molecular Weight 72675.45 Da.
    Residues 640 Isoelectric Point 5.31
    Sequence meereltlsdillmfkrrsklfwlvlvltvfatgiylflatpqyeayarvkvstqkgmrlglsiegllg glssllggggsqedeiqimlsrrniiavideldlvhklldekdiekakknglteddlklslysymvekl itvepvknssilevkvtwhepklaaeiankivenytkiseniaksqlgakmdfleeqipkveqelkeae sklkvfkeqnriysveaqtqvlidryasllqkmeeariameatqkqseffskelkdldieieqikdsit fdpiisqlksnminiqielaglmerytetnpavvqkkaelqetqkqleielkrlltsqvkktgnpvyee alsslikaesekilyqsqyeafkklyedmekelsklpeleqklielerdykvketiyttllqakyesli seaaitananvidwavpplepskpnkkltlaiggvlgiflgilavffaefsdrrikseseaeyllglek ivarvpltqneevmekalgipavksgkvtfitaledgagvstlakhmakllskkekvlllteekvegtf drkdvfdllknpdvleelkerydkiivdapslkrtpdflpiaeksdtvyivirlehtlsedlktlhtlk kidgfilngltkknstyve
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Modeled
    Model TM0644
    generated 12/2008
    Transmembrane protein

    HMM_TM0644

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch