.
The Open Protein Structure Annotation Network
PDB Keyword
.

282528

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282528
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19110,TM0656, 2.60.120.10, _0113.000641_, _0078.003353_, 84733 Molecular Weight 20433.18 Da.
    Residues 176 Isoelectric Point 5.13
    Sequence mrigeklrklrlsrgltqeelaertdlsrsfisqlesdktspsidtlerilealgtdlkhffsdveeer ivfkkeervpvydepegvkseilmsgvedkeidpilvtlepgaqteeesyhegsefgfviqgridlyld gkryrlkegdcfyykadkkhyvknpgkkkavllwimid
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch