.
The Open Protein Structure Annotation Network
PDB Keyword
.

282547

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282547
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS33028,TM0676, 89310, 89920 Molecular Weight 28608.00 Da.
    Residues 262 Isoelectric Point 4.78
    Sequence mdlatlmglvlviaalfigiltgggdfaafinipslfitvvgsiaatmvahpkdkafkivnimlstlke pkldhvsliqtmvsfsekarregllsleenlesiedpfmkkalqlvvdgtdpdllrnmmetemelfeee ldgeravlesagayapafgmigtligliqmlkslndpetlgpsmavalittlygailangvflpmaeki kkrrdilvlekrmileavlsiqagenprileeklksflpekerqayeaasqeata
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0676

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch