The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282565
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2112,TM0695, 85004 Molecular Weight 22571.83 Da.
    Residues 203 Isoelectric Point 5.37
    Sequence mtvkekkiidqyvpivvestgryeraydifsrllkdrivflgspiddyvanlviaqllfleaedpdkdv ylyinspggsvtaglaiydtmqyikcdvsticvgqaasmaavllaagakgkryalpnarimihqplgga egpakdveiitrellrikdllnrilskhtgqpiekiekdtdrdffmsaeeakeygivdkvvstre
      BLAST   FFAS

    Ligand Information
    Model TM0695
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch