.
The Open Protein Structure Annotation Network
PDB Keyword
.

282567

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Selected
    Target Id 282567
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32932,TM0697 Molecular Weight 10088.86 Da.
    Residues 88 Isoelectric Point 5.00
    Sequence mtievfldimksgisllleiivpplvvslivglvisifqavtqiheqtlmfapriivlfltilflsgwm aqkildffsemlqkyfqmi
      BLAST   FFAS

    Ligand Information
    Ligands
    Metals
    Transmembrane protein

    HMM_TM0697

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch