The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282610
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2126,TM0740 Molecular Weight 74557.84 Da.
    Residues 640 Isoelectric Point 6.16
    Sequence mkikvklpdgkekeydrgitpaeiakelgikkaigavvngelwdlkrpiendcelrlvtledpeapefy rhtmahilaqavmrlygkenvklgigptiengfyydfdikngrlteedlpkieqemkkiikenlpierk eiskeearelfrdqpyklelieeiegnrvtiyrqgefvdlcrgphlpstgivkhfkllsvsgaywrgse knpmltrvygtafakkedldnylkfleeaqrrdhrklgpqlelfmlnteyapgmpfflpkgvvvlnelm kfsrelhrergyqeiftplimneqlwkisghwdhyaenmyfiekdeeryavkpmncpghilvyksrtvs yrdlplrffefgrvhryersgvlhglmrvrsftqddahifctpdqieeeilgvldlintiysqfgftyr velstmpedhmgdeaiwekattalknaleraglsykvnegegafygpkidfhirdsigrewqcatiqld fmmpekfnvtyigpdnkehravmihraiygslerffgiliehfagafptwlapiqvavipisekhndga ekvarrisqegfrvffdnrretlgyrirqaqtqkipymiiigdkelesgkisvrtrtgkeikdvdpehf vetlrnevlsrklelsmeg
      BLAST   FFAS


    Reactions found in Metabolic Reconstruction for TM0740

    Name: Threonyl-tRNA synthetase
    Metabolic Subsystem: Threonine Metabolism
    Reaction: : atp + thr-L + trnathr --> amp + ppi + thrtrna
    Classification: EC:

    Ligand Information
    Model TM0740
    generated 12/2008

    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch