.
The Open Protein Structure Annotation Network
PDB Keyword
.

282614

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Purified
    Target Id 282614
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS2129,TM0744, _0020.002700_, _0106.001312_, _0023.002585_, _0062.000714_, _0055.004099_, _0037.002508_, BIG_326, _0063.005062_, _0109.000793_, _0061.001192_, 85021, 90085 Molecular Weight 47034.17 Da.
    Residues 406 Isoelectric Point 6.47
    Sequence mniamfsdtyapqingvatsirvykkklterghkvvvvapsapeeekdvfvvrsipfpfepqhrisias tknilefmrennvqiihshspffigfkalrvqeemglphvhtyhtllpeyrhyipkpftppkrlvehfs awfcnmtnvviaptedikrelesygvkrpievlptgievekfeveapeelkrkwnpegkkvvlyagria keknldfllrvfeslnapgiafimvgdgpereeveefakekgldlkitgfvphdeiplyyklgdvfvfa sktetqglvllealasglpvvalkwkgvkdvlknceaavlieeenerlfaekikhilkndrlreelstk grefvrkewsvdrfvqrleeiytraieegpveintslmikefvkfeklkeffskiedriwr
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch