The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282615
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS32798,TM0745, 289565 Molecular Weight 16657.25 Da.
    Residues 142 Isoelectric Point 9.56
    Sequence mmlnlinlddsgkkysflvpilvffvntvvfwndiamvynslrillkifedfflfflyslsisglykti tnrapaemmwalspyvflpllsafldvrisllilffaslflfrklelknlilislvrasalclfiwkis swmr
      BLAST   FFAS

    Ligand Information
    Transmembrane protein


    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch