.
The Open Protein Structure Annotation Network
PDB Keyword
.

282621

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site JCSG
    Status Expressed
    Target Id 282621
    Molecular Characteristics
    Source Thermotoga maritima msb8
    Alias Ids TPS19158,TM0751, BIG_267, 382425 Molecular Weight 64983.81 Da.
    Residues 555 Isoelectric Point 8.90
    Sequence mrkitlrskldgreivfeenqnlfdiareyqkyyrykilaarvnnriielfrtpdrsgelefldltdpd glriyqrglvflaslavrklnsewrlkvlhslgkgiyceiykgnelivpdqnqvfaikdkmrelvekdl piekrtfykdeareilmkeglvktvnlfkyrkkrtvklyhcdgfwayfygylppstgridvfdvqpynq glvlvhpdpktrelpvihmpklsqvfleyarwlnvleleyvsdlndiiargerhvadlmllsealhekk isdiadeiakdkrkrliliagpsssgkttfakrlslqlrvnglkpvaislddyfvdrektprdengnyd fdsiealdielfnrnlqdllagkevvlpkfnfktgkrmrgptlklekdniiivegihglnerltasipk eqkfkiyvsaltqlniddhnrvtttdtrlirrivrdykfrghtaydtlkmwpnvrkgeernifpfqeea dvmfnsalvyeipvlrifaepllvqvpedvpeysealrllklldfflpitniedipdksilrefigrsifky
      BLAST   FFAS
    Ligand Information
    Ligands
    Metals

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch